Hooke Kits™ for EAE Induction in C57BL/6 Mice
Also for EAE induction in (C57BL/6 x SJL)F1 mice
Emulsion supplied in pre-filled syringes, ready to use.
- Consistently induces EAE in female C57BL/6 mice
EAE develops in 90 to 100% of untreated mice. In most mice disease onset occurs between 9 and 16 days after immunization. Most mice will reach a maximum score of 3.0 to 3.5.
Each lot is tested and individually adjusted to ensure consistent disease induction.
On Day 0, MOG35-55/CFA or MOG1-125/CFA emulsion and pertussis toxin are injected.
On Day 1, a second dose of pertussis toxin is injected.
- Eliminates tedious preparation of emulsions
Properly prepared emulsions are critical for reliable induction of many autoimmune disease models. Our emulsions are carefully made and pre-filled into syringes, ready to use, to reduce time needed to set up experiments.
- Saves time and mice in testing individual reagents
Lot-to-lot reagent variations can cause dramatic changes in severity of induced autoimmune disease. The consistent potency of pre-characterized Hooke Kits™ eliminates time-consuming testing.
- Reduces your mouse facility's exposure to pathogen contamination
Pre-filled syringes are prepared under aseptic conditions and delivered in sterilized plastic bags for easy disinfection before introduction into your mouse facility.
Experimental autoimmune encephalomyelitis (EAE) is the model most commonly used to study efficacy of potential drugs for treatment of multiple sclerosis (MS).
Because of its many similarities to MS, EAE is used to study pathogenesis of autoimmunity, CNS inflammation, demyelination, cell trafficking and tolerance induction.
EAE is characterized by paralysis (in some models the paralysis is relapsing-remitting), CNS inflammation and demyelination. EAE is initiated by myelin-specific CD4+ T cells, with glia cells (microglia and astrocytes), B cells, macrophages, NK cells, and dendritic cells all playing important roles in disease development.
Kit selection
MOG35-55 antigen (EK-2110) is recommended for study of onset and development of EAE and testing efficacy of potential therapeutics. The induced immune response will be directed against a single epitope. This antigen will consistently induce T cell responses, but will not consistently induce B cell responses, and as a result there will be no consistent anti-MOG35-55 antibody production. EAE severity does not correlate with antibody production. EAE induced with this emulsion is not B cell dependent.
MOG1-125 antigen (EK-2160) induces a response directed against multiple epitopes and will induce consistent anti-MOG1-125 antibody production. EAE induced with this emulsion is B cell dependent. Our EK-2160 kit is therefore recommended for testing therapeutics which specifically target B cells [1, 2, 3].
For more information on model and antigen selection, please see Learning Center - What are the advantages and disadvantages of the different EAE models and antigens?.
Cat # | Hooke Kit™ | Strain | Age | Description | Size | Price (first kit) |
Price (each add'l kit) |
---|---|---|---|---|---|---|---|
EK-2110 | MOG35-55/CFA Emulsion PTX | C57BL/6 | 9 to 13 weeks | Emulsion in syringes, PTX | 10 mice | $ 399 | $ 339 |
EK-2160 | MOG1-125/CFA Emulsion PTX | C57BL/6 | 9 to 13 weeks | Emulsion in syringes, PTX | 10 mice | $ 2087 | $ 1668 |
These kits can be customized for a small additional charge. Contact us at or with your requirements.
With a given Hooke Kit™, older mice generally develop more severe disease and more uniform disease onset.
Protocol
EAE Induction by Active Immunization in C57BL/6 Mice
Note: These kits may also be used to induce EAE in in (C57BL/6 x SJL)F1 mice.
Detailed contents
Each kit provides sufficient reagents for 10 mice.
EK-2110 antigen is myelin oligodendrocyte glycoprotein 35-55 (MOG35-55) rat, mouse, sequence MEVGWYRSPFSRVVHLYRNGK.
EK-2160 antigen is human recombinant myelin oligodendrocyte glycoprotein 1-125
(MOG1-125), sequence MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGG
FTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH.
Qty | Description |
---|---|
3 | Syringes pre-filled with 0.7 mL antigen/CFA emulsion ~ 1 mg MOG35-55/mL emulsion (EK-2110) ~ 0.5 mg MOG1-125/mL emulsion (EK-2160) ~ 2-5 mg killed mycobacterium tuberculosis H37Ra/mL emulsion (all concentrations adjusted by lot for consistent EAE induction) |
1 | Vial containing 3 to 6 µg pertussis toxin (PTX) in glycerol buffer (amount is adjusted by lot for consistent EAE induction; see protocol) |
1 | Data sheet: Recommended experimental protocol, typical results |
Typical results
EAE induction in C57BL/6 mice
Protocol: EAE Induction by Active Immunization in C57BL/6 Mice
Data are from three independent groups in a single experiment. Immunization used Hooke Kit™ MOG35-55/CFA Emulsion PTX (EK-2110), with 11 to 13 week old female C57BL/6 mice (Taconic Biosciences).
Pertussis toxin from 3 vials was pooled before administration.
Similar results are obtained using C57BL/6 mice from The Jackson Laboratory, as well as with MOG1-125/CFA Emulsion PTX (EK-2160) using the recommended protocol.
Group | Mice/group | Age at immunization |
Mean maximum score ± SD |
Day of onset ± SD |
Disease incidence |
---|---|---|---|---|---|
1 | 11 | 11-13 weeks | 3.46 ± 0.14 | 11.3 ± 1.4 | 100 % |
2 | 11 | 11-13 weeks | 3.36 ± 0.32 | 11.7 ± 1.8 | 100 % |
3 | 11 | 11-13 weeks | 3.18 ± 0.56 | 11.3 ± 1.7 | 100 % |
Storage & stability
Stable for 20 days when stored at 2–4 °C.
Do not freeze.
References
[1] Lyons JA et al, Eur J Imm 29:3432 (1999)
[2] Svensson L et al, Eur J Imm 32:1939 (2002)
[3] Lyons JA et al, Eur J Imm 32:190 (2002)
Product citations
Search Google Scholar for product citations (opens in new tab)
Safety Data Sheets (SDS)
EK-2110:
MOG35-55/CFA Emulsion (PDF) and
Pertussis toxin in glycerol (PDF)
EK-2160:
MOG1-125/CFA Emulsion (PDF) and
Pertussis toxin in glycerol (PDF)
Related products
BT-0105 Pertussis toxin in glycerol
DS-0111 MOG35-55 in TC media
CK-2110
Hooke Control Kit™ for EK-2110 (full size)
CK-7110
Hooke Control Kit™ for EK-2110 (half size)
CK-2160
Hooke Control Kit™ for EK-2160 (full size)
CK-7160
Hooke Control Kit™ for EK-2160 (half size)